TMEM48 antibody - middle region (ARP46268_P050) | Aviva Systems Biology ARP46268 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

TMEM48 antibody - middle region (ARP46268_P050)

catalog :

ARP46268

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP46268

product type :

Polyclonal Antibody

category :

Polyclonal

name :

TMEM48 antibody - middle region (ARP46268_P050)

size :

100 ul

gene symbol :

NDC1

alias symbols :

FLJ10407, FLJ12556, FLJ34120, NDC1, RP4-654H19.1, NET3, TMEM48

nucleotide accession num :

NM_018087

protein accession num :

NP_060557

swissprot id :

Q9BTX1

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNW
TAISRECLNLL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human TMEM48

drywet surcharge :

Wet Ice

storage temperature :

-20C