USP18 antibody - N-terminal region (ARP46253_P050) | Aviva Systems Biology ARP46253 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

USP18 antibody - N-terminal region (ARP46253_P050)

catalog :

ARP46253

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP46253

product type :

Polyclonal Antibody

category :

Polyclonal

name :

USP18 antibody - N-terminal region (ARP46253_P050)

size :

100 ul

gene symbol :

USP18

alias symbols :

ISG43, UBP43

nucleotide accession num :

NM_017414

protein accession num :

NP_059110

swissprot id :

Q9UMW8

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLW
NLIKDQITDVH
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-232 AC879.24 8964-81195 233-495 AC879.24 88531-88793 496-592 AC879.24 91145-91241 593-738 AC879.24 92763-9298 739-818 AC879.24 98228-9837 819-965 AC879.24 98863-999 966-161 AC879.24 1817-1912 162-1229 AC879.24 11726-11893 123-1361 AC879.24 14123-14254 1362-1411 AC879.24 14766-14815 1412-237 AC879.24 17745-1837

host :

Rabbit

application :

homology :

Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human USP18

drywet surcharge :

Wet Ice

storage temperature :

-20C