APOBEC3B antibody - N-terminal region (ARP46114_P050) | Aviva Systems Biology ARP46114 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

APOBEC3B antibody - N-terminal region (ARP46114_P050)

catalog :

ARP46114

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, bovine

application :

western blot

product information

sku :

ARP46114

product type :

Polyclonal Antibody

category :

Polyclonal

name :

APOBEC3B antibody - N-terminal region (ARP46114_P050)

size :

100 ul

gene symbol :

APOBEC3B

alias symbols :

APOBEC1L, ARCD3, ARP4, DJ742C19.2, FLJ21201, PHRBNL, bK150C2.2

nucleotide accession num :

NM_004900

protein accession num :

NP_004891

swissprot id :

Q9UH17

species reactivity :

Cow, Horse, Human, Pig, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTL
TISAARLYYYW
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

APOBEC3B is a member of the cytidine deaminase family. It is thought that these proteins may be RNA editing enzymes and have roles in growth or cell cycle control.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

host :

Rabbit

application :

homology :

Cow: 82%; Horse: 91%; Human: 100%; Pig: 92%; Rabbit: 82%; Rat: 91%; Zebrafish: 90%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3B

drywet surcharge :

Wet Ice

storage temperature :

-20C