MX1 antibody - C-terminal region (ARP46077_P050) | Aviva Systems Biology ARP46077 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

MX1 antibody - C-terminal region (ARP46077_P050)

catalog :

ARP46077

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, dogs, bovine

application :

western blot

product information

sku :

ARP46077

product type :

Polyclonal Antibody

category :

Polyclonal

name :

MX1 antibody - C-terminal region (ARP46077_P050)

size :

100 ul

gene symbol :

MX1

alias symbols :

IFI-78K, IFI78, MX, MxA

nucleotide accession num :

NM_002462

protein accession num :

NP_002453

swissprot id :

P20591

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQ
ARRRLAQFPG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human MX1

drywet surcharge :

Wet Ice

storage temperature :

-20C