RRM2 antibody - N-terminal region (ARP46031_P050) | Aviva Systems Biology ARP46031 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RRM2 antibody - N-terminal region (ARP46031_P050)

catalog :

ARP46031

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, dogs, bovine

application :

western blot

product information

sku :

ARP46031

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RRM2 antibody - N-terminal region (ARP46031_P050)

size :

100 ul

gene symbol :

RRM2

alias symbols :

R2, RR2M, RR2

nucleotide accession num :

NM_001034

protein accession num :

NP_001025

swissprot id :

P31350

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLL
RENPRRFVIFP
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human RRM2

drywet surcharge :

Wet Ice

storage temperature :

-20C