PFKL antibody - middle region (ARP45774_T100) | Aviva Systems Biology ARP45774 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

PFKL antibody - middle region (ARP45774_T100)

catalog :

ARP45774

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP45774

product type :

Polyclonal Antibody

category :

Polyclonal

name :

PFKL antibody - middle region (ARP45774_T100)

size :

100 ul

gene symbol :

PFKL

alias symbols :

DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, PFK-B

nucleotide accession num :

NM_002626

protein accession num :

AAH18295

swissprot id :

P17858

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLRE
VYRKGRVFANA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 93%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human PFKL

drywet surcharge :

Wet Ice

storage temperature :

-20C