This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
BAAT antibody - N-terminal region (ARP45686_P050)
catalog :
ARP45686
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
sku :
ARP45686
product type :
Polyclonal Antibody
category :
Polyclonal
name :
BAAT antibody - N-terminal region (ARP45686_P050)
size :
100 ul
gene symbol :
BAAT
alias symbols :
BACAT, BAT, FLJ20300, MGC104432
nucleotide accession num :
NM_001701
protein accession num :
NP_001692
swissprot id :
Q14032
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDEN
GDMFYSQAHYR
Synthetic peptide located within the following region:
GDMFYSQAHYR
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.
host :
Rabbit
application :
WB
homology :
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human BAAT
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments