This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
KNG1 antibody - middle region (ARP45680_P050)
catalog :
ARP45680
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
product information
sku :
ARP45680
product type :
Polyclonal Antibody
category :
Polyclonal
name :
KNG1 antibody - middle region (ARP45680_P050)
size :
100 ul
gene symbol :
KNG1
alias symbols :
BDK, KNG
nucleotide accession num :
NM_001102416
protein accession num :
NP_001095886
swissprot id :
P01042
species reactivity :
Horse, Human, Mouse, Pig
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKL
NAENNATFYFK
Synthetic peptide located within the following region:
NAENNATFYFK
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
host :
Rabbit
application :
WB
homology :
Horse: 85%; Human: 100%; Mouse: 77%; Pig: 92%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human KNG1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
