This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
ARG1 antibody - C-terminal region (ARP45673_T100)
catalog :
ARP45673
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry
product information
sku :
ARP45673
product type :
Polyclonal Antibody
category :
Polyclonal
name :
ARG1 antibody - C-terminal region (ARP45673_T100)
size :
100 ul
gene symbol :
ARG1
alias symbols :
-
nucleotide accession num :
NM_000045
protein accession num :
NP_000036
swissprot id :
P05089
species reactivity :
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGN
HKPIDYLNPPK
Synthetic peptide located within the following region:
HKPIDYLNPPK
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.
host :
Rabbit
application :
IHC, WB
homology :
Cow: 93%; Dog: 100%; Goat: 93%; Horse: 83%; Human: 100%; Mouse: 80%; Pig: 93%; Rabbit: 93%; Rat: 87%
purification :
Protein A purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the C terminal region of human ARG1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments