RORC antibody - N-terminal region (ARP45622_P050) | Aviva Systems Biology ARP45622 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RORC antibody - N-terminal region (ARP45622_P050)

catalog :

ARP45622

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine

application :

western blot, immunohistochemistry, immunocytochemistry

product information

sku :

ARP45622

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RORC antibody - N-terminal region (ARP45622_P050)

size :

100 ul

gene symbol :

RORC

alias symbols :

MGC129539, NR1F3, RORG, RZRG, TOR, RZR-GAMMA

nucleotide accession num :

NM_001001523

protein accession num :

NP_001001523

swissprot id :

Q5SZR9

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEA
SACPPGLLKAS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.

host :

Rabbit

application :

WB, IHC, IF

homology :

Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human RORC

drywet surcharge :

Wet Ice

storage temperature :

-20C