DEGS1 antibody - N-terminal region (ARP45501_P050) | Aviva Systems Biology ARP45501 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

DEGS1 antibody - N-terminal region (ARP45501_P050)

catalog :

ARP45501

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP45501

product type :

Polyclonal Antibody

category :

Polyclonal

name :

DEGS1 antibody - N-terminal region (ARP45501_P050)

size :

100 ul

gene symbol :

DEGS1

alias symbols :

DEGS, DES1, Des-1, FADS7, MGC5079, MIG15, MLD, DEGS-1

nucleotide accession num :

NM_003676

protein accession num :

NP_003667

swissprot id :

O15121

species reactivity :

Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPD
PNLIWIIIMMV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified.

host :

Rabbit

application :

WB, IHC

homology :

Cow: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human DEGS1

drywet surcharge :

Wet Ice

storage temperature :

-20C