DSG2 antibody - N-terminal region (ARP45198_P050) | Aviva Systems Biology ARP45198 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

DSG2 antibody - N-terminal region (ARP45198_P050)

catalog :

ARP45198

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP45198

product type :

Polyclonal Antibody

category :

Polyclonal

name :

DSG2 antibody - N-terminal region (ARP45198_P050)

size :

100 ul

gene symbol :

DSG2

alias symbols :

ARVC10, ARVD10, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, CMD1BB

nucleotide accession num :

NM_001943

protein accession num :

NP_001934

swissprot id :

Q14126

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGE
LNVTSILDREE
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human DSG2

drywet surcharge :

Wet Ice

storage temperature :

-20C