C1QB antibody - C-terminal region (ARP44297_P050) | Aviva Systems Biology ARP44297 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

C1QB antibody - C-terminal region (ARP44297_P050)

catalog :

ARP44297

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, dogs

application :

western blot, immunohistochemistry

product information

sku :

ARP44297

product type :

Polyclonal Antibody

category :

Polyclonal

name :

C1QB antibody - C-terminal region (ARP44297_P050)

size :

100 ul

gene symbol :

C1QB

alias symbols :

nucleotide accession num :

NM_000491

protein accession num :

NP_000482

swissprot id :

P02746

species reactivity :

Dog, Horse, Human

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGAN
SIFSGFLLFPD
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q.

host :

Rabbit

application :

IHC, WB

homology :

Dog: 92%; Horse: 82%; Human: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human C1QB

drywet surcharge :

Wet Ice

storage temperature :

-20C