BCHE antibody - N-terminal region (ARP44208_T100) | Aviva Systems Biology ARP44208 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

BCHE antibody - N-terminal region (ARP44208_T100)

catalog :

ARP44208

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP44208

product type :

Polyclonal Antibody

category :

Polyclonal

name :

BCHE antibody - N-terminal region (ARP44208_T100)

size :

100 ul

gene symbol :

BCHE

alias symbols :

CHE1, E1

nucleotide accession num :

NM_000055

protein accession num :

NP_000046

swissprot id :

P06276

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPE
APGNMGLFDQQ
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human BCHE

drywet surcharge :

Wet Ice

storage temperature :

-20C