ADH4 antibody - middle region (ARP43573_T100) | Aviva Systems Biology ARP43573 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ADH4 antibody - middle region (ARP43573_T100)

catalog :

ARP43573

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP43573

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ADH4 antibody - middle region (ARP43573_T100)

size :

100 ul

gene symbol :

ADH4

alias symbols :

ADH-2

nucleotide accession num :

NM_000670

protein accession num :

NP_000661

swissprot id :

P08319

species reactivity :

Cow, Dog, Human, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVD
FALDCAGGSET
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 86%; Dog: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human ADH4

drywet surcharge :

Wet Ice

storage temperature :

-20C