ECH1 antibody - N-terminal region (ARP43560_T100) | Aviva Systems Biology ARP43560 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ECH1 antibody - N-terminal region (ARP43560_T100)

catalog :

ARP43560

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP43560

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ECH1 antibody - N-terminal region (ARP43560_T100)

size :

100 ul

gene symbol :

ECH1

alias symbols :

HPXEL

nucleotide accession num :

NM_001398

protein accession num :

NP_001389

swissprot id :

Q13011

species reactivity :

Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREM
VECFNKISRDA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human ECH1

drywet surcharge :

Wet Ice

storage temperature :

-20C