This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
ZNF294 antibody - N-terminal region (ARP43201_P050)
catalog :
ARP43201
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot
product information
sku :
ARP43201
product type :
Polyclonal Antibody
category :
Polyclonal
name :
ZNF294 antibody - N-terminal region (ARP43201_P050)
size :
100 ul
gene symbol :
LTN1
alias symbols :
C21orf10, C21orf98, FLJ11053, KIAA0714, RNF160, ZNF294
nucleotide accession num :
NM_015565
protein accession num :
NP_056380
swissprot id :
O94822
species reactivity :
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFG
TSQSDLGYVPA
Synthetic peptide located within the following region:
TSQSDLGYVPA
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF294
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
