This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
FBXW2 antibody - middle region (ARP43109_P050)
catalog :
ARP43109
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot
product information
sku :
ARP43109
product type :
Polyclonal Antibody
category :
Polyclonal
name :
FBXW2 antibody - middle region (ARP43109_P050)
size :
100 ul
gene symbol :
FBXW2
alias symbols :
FBW2, Fwd2, MGC117371, Md6
nucleotide accession num :
NM_012164
protein accession num :
NP_036296
swissprot id :
Q9UKT8
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGL
VFATSMPDHSI
Synthetic peptide located within the following region:
VFATSMPDHSI
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 4 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-4 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. FBXW2 is the second identified member of the F-box family and contains multiple WD-4 repeats.F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 4 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-4 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. This gene encodes the second identified member of the F-box gene family and contains multiple WD-4 repeats.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human FBXW2
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
