FBXW2 antibody - middle region (ARP43109_P050) | Aviva Systems Biology ARP43109 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FBXW2 antibody - middle region (ARP43109_P050)

catalog :

ARP43109

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP43109

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FBXW2 antibody - middle region (ARP43109_P050)

size :

100 ul

gene symbol :

FBXW2

alias symbols :

FBW2, Fwd2, MGC117371, Md6

nucleotide accession num :

NM_012164

protein accession num :

NP_036296

swissprot id :

Q9UKT8

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGL
VFATSMPDHSI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 4 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-4 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. FBXW2 is the second identified member of the F-box family and contains multiple WD-4 repeats.F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 4 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-4 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. This gene encodes the second identified member of the F-box gene family and contains multiple WD-4 repeats.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human FBXW2

drywet surcharge :

Wet Ice

storage temperature :

-20C