This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
RFFL antibody - middle region (ARP42986_P050)
catalog :
ARP42986
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
sku :
ARP42986
product type :
Polyclonal Antibody
category :
Polyclonal
name :
RFFL antibody - middle region (ARP42986_P050)
size :
100 ul
gene symbol :
RFFL
alias symbols :
RNF189, RNF34L, CARP2, FRING, CARP-2, RIFIFYLIN
nucleotide accession num :
NM_001017368
protein accession num :
NP_001017368
swissprot id :
Q8WZ73
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPID
CVLLECGHMVT
Synthetic peptide located within the following region:
CVLLECGHMVT
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP1 by targeting them for proteasomal degradation. Has anti-apoptotic activity.RFFL may bind phosphatidylinositol phosphates.
host :
Rabbit
application :
WB
homology :
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human RFFL
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
