AMOTL1 antibody - N-terminal region (ARP42927_P050) | Aviva Systems Biology ARP42927 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

AMOTL1 antibody - N-terminal region (ARP42927_P050)

catalog :

ARP42927

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine

application :

western blot

product information

sku :

ARP42927

product type :

Polyclonal Antibody

category :

Polyclonal

name :

AMOTL1 antibody - N-terminal region (ARP42927_P050)

size :

100 ul

gene symbol :

AMOTL1

alias symbols :

JEAP

nucleotide accession num :

NM_130847

protein accession num :

NP_570899

swissprot id :

Q8IY63

species reactivity :

Cow, Dog, Guinea Pig, Human, Mouse, Rabbit

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQ
QNNEELPTYEE
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1

drywet surcharge :

Wet Ice

storage temperature :

-20C