This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
COX4I1 antibody - N-terminal region (ARP42784_T100)
catalog :
ARP42784
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry
product information
sku :
ARP42784
product type :
Polyclonal Antibody
category :
Polyclonal
name :
COX4I1 antibody - N-terminal region (ARP42784_T100)
size :
100 ul
gene symbol :
COX4I1
alias symbols :
COX4, COXIV, MGC72016, COX4-1
nucleotide accession num :
NM_001861
protein accession num :
NP_001852
swissprot id :
P13073
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHV
KHLSASQKALK
Synthetic peptide located within the following region:
KHLSASQKALK
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it.
host :
Rabbit
application :
IHC, WB
homology :
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86%
purification :
Protein A purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments