EDG8 antibody - N-terminal region (ARP42661_T100) | Aviva Systems Biology ARP42661 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

EDG8 antibody - N-terminal region (ARP42661_T100)

catalog :

ARP42661

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP42661

product type :

Polyclonal Antibody

category :

Polyclonal

name :

EDG8 antibody - N-terminal region (ARP42661_T100)

size :

100 ul

gene symbol :

S1PR5

alias symbols :

Edg-8, S1P5, S1PR5, SPPR-1, SPPR-2, EDG8

nucleotide accession num :

NM_003339

protein accession num :

EAW84115

swissprot id :

Q9H228

species reactivity :

Cow, Dog, Human, Mouse, Pig, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRAD
AVVCLAVCAFI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 80%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human EDG8

drywet surcharge :

Wet Ice

storage temperature :

-20C