SLC38A4 antibody - middle region (ARP42504_T100) | Aviva Systems Biology ARP42504 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

SLC38A4 antibody - middle region (ARP42504_T100)

catalog :

ARP42504

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP42504

product type :

Polyclonal Antibody

category :

Polyclonal

name :

SLC38A4 antibody - middle region (ARP42504_T100)

size :

100 ul

gene symbol :

SLC38A4

alias symbols :

ATA3, FLJ10191, MGC126876, NAT3, PAAT

nucleotide accession num :

NM_003345

protein accession num :

NP_060488

swissprot id :

Q969I6

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAV
LVAVTLTVPIV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene.

host :

Rabbit

application :

WB, IHC

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 90%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human SLC38A4

drywet surcharge :

Wet Ice

storage temperature :

-20C