CEMIP2 Antibody - middle region (ARP42382_P050) | Aviva Systems Biology ARP42382 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CEMIP2 Antibody - middle region (ARP42382_P050)

catalog :

ARP42382

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP42382

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CEMIP2 Antibody - middle region (ARP42382_P050)

size :

100 ul

gene symbol :

CEMIP2

alias symbols :

TMEM2

nucleotide accession num :

NM_013390

protein accession num :

NP_037522

swissprot id :

Q9UHN6

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQR
GDPSVISVNGT
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

This gene encodes a type II transmembrane protein that belongs to the interferon-induced transmembrane (IFITM) protein superfamily. The encoded protein functions as a cell surface hyaluronidase that cleaves extracellular high molecular weight hyaluronan into intermediate size fragments before internalization and degradation in the lysosome. It also has an interferon-mediated antiviral function in humans through activation of the JAK STAT signaling pathway. The activation of this gene by transcription factor SOX4 in breast cancer cells has been shown to mediate the pathological effects of SOX4 on cancer progression. Naturally occurring mutations in this gene are associated with autosomal recessive non-syndromic hearing loss.

host :

Rabbit

application :

homology :

Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human TMEM2

drywet surcharge :

Wet Ice

storage temperature :

-20C