PPP2R3B antibody - C-terminal region (ARP42370_P050) | Aviva Systems Biology ARP42370 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

PPP2R3B antibody - C-terminal region (ARP42370_P050)

catalog :

ARP42370

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, dogs, zebrafish

application :

western blot

product information

sku :

ARP42370

product type :

Polyclonal Antibody

category :

Polyclonal

name :

PPP2R3B antibody - C-terminal region (ARP42370_P050)

size :

100 ul

gene symbol :

PPP2R3B

alias symbols :

NY-REN-8, PPP2R3L, PPP2R3LY, PR48, NYREN8

nucleotide accession num :

NM_013239

protein accession num :

NP_037371

swissprot id :

Q9Y5P8

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAE
EYDILVAEETA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. PPP2R3B belongs to the B'' family. The B'' family has been further divided into subfamilies. PPP2R3B belongs to the beta subfamily of regulatory subunit B''.Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 77%; Rabbit: 77%; Rat: 82%; Zebrafish: 85%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human PPP2R3B

drywet surcharge :

Wet Ice

storage temperature :

-20C