ATP6V0A2 antibody - N-terminal region (ARP42365_P050) | Aviva Systems Biology ARP42365 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ATP6V0A2 antibody - N-terminal region (ARP42365_P050)

catalog :

ARP42365

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP42365

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ATP6V0A2 antibody - N-terminal region (ARP42365_P050)

size :

100 ul

gene symbol :

ATP6V0A2

alias symbols :

ATP6N1D, ATP6a2, J6B7, Stv1, TJ6, TJ6M, TJ6s, Vph1, a2, A2, RTF, WSS, ARCL, STV1, TJ6S, VPH1, ARCL2A, ATP6A2

nucleotide accession num :

NM_012463

protein accession num :

NP_036595

swissprot id :

Q9Y487

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELRE
VTKNKEKLRKN
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V() domain; ATP6VA2 is a component of the V() domain.The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V() domain; ATP6VA2 is a component of the V() domain (Smith et al., 23 [PubMed 1458332]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%; Yeast: 79%; Zebrafish: 77%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V0A2

drywet surcharge :

Wet Ice

storage temperature :

-20C