This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
SARDH antibody - middle region (ARP42344_T100)
catalog :
ARP42344
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot, immunohistochemistry
product information
sku :
ARP42344
product type :
Polyclonal Antibody
category :
Polyclonal
name :
SARDH antibody - middle region (ARP42344_T100)
size :
100 ul
gene symbol :
SARDH
alias symbols :
DMGDHL1, FLJ36475, SAR, SARD, SDH, BPR-2
nucleotide accession num :
NM_001134707
protein accession num :
AAH33217
swissprot id :
Q9UL12
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLH
EELLGQGCVFQ
Synthetic peptide located within the following region:
EELLGQGCVFQ
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
The function remains known.
host :
Rabbit
application :
IHC, WB
homology :
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
purification :
Protein A purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human SARDH
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
