This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
STATH antibody - middle region (ARP42102_P050)
catalog :
ARP42102
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
sku :
ARP42102
product type :
Polyclonal Antibody
category :
Polyclonal
name :
STATH antibody - middle region (ARP42102_P050)
size :
100 ul
gene symbol :
STATH
alias symbols :
STR
nucleotide accession num :
NM_003154
protein accession num :
NP_003145
swissprot id :
P02808
species reactivity :
Human, Yeast
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGP
YQPVPEQPLYP
Synthetic peptide located within the following region:
YQPVPEQPLYP
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
STATH is a salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
host :
Rabbit
application :
WB
homology :
Human: 100%; Yeast: 90%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human STATH
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
