BDNF antibody - middle region (ARP41970_P050) | Aviva Systems Biology ARP41970 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

BDNF antibody - middle region (ARP41970_P050)

catalog :

ARP41970

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs

application :

western blot, immunohistochemistry

citations: 1

Reference
Louis Sam Titus A, Sharma D, Kim M, D Mello S. The Bdnf and Npas4 genes are targets of HDAC3-mediated transcriptional repression. BMC Neurosci. 2019;20:65 pubmed publisher

product information

sku :

ARP41970

product type :

Polyclonal Antibody

category :

Polyclonal

name :

BDNF antibody - middle region (ARP41970_P050)

size :

100 ul

gene symbol :

BDNF

alias symbols :

MGC34632

nucleotide accession num :

NM_001709

protein accession num :

NP_001700

swissprot id :

P23560

species reactivity :

Dog, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYET
KCNPMGYTKEG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.

host :

Rabbit

application :

IHC, WB

homology :

Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human BDNF

drywet surcharge :

Wet Ice

storage temperature :

-20C