CYP3A7 antibody - middle region (ARP41801_T100) | Aviva Systems Biology ARP41801 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CYP3A7 antibody - middle region (ARP41801_T100)

catalog :

ARP41801

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot

product information

sku :

ARP41801

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CYP3A7 antibody - middle region (ARP41801_T100)

size :

100 ul

gene symbol :

CYP3A7

alias symbols :

CP37, P450-HFLA, CYPIIIA7

nucleotide accession num :

NM_000765

protein accession num :

NP_000756

swissprot id :

P24462

species reactivity :

Cow, Dog, Guinea Pig, Human, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKA
LSDLELMAQSI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

CYP3A7 is a member of the cytochrome P45 superfamily of enzymes. The cytochrome P45 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P45 superfamily of enzymes. The cytochrome P45 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P45 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.

host :

Rabbit

application :

homology :

Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7

drywet surcharge :

Wet Ice

storage temperature :

-20C