This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
LEP Antibody - middle region (ARP41698_P050)
catalog :
ARP41698
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry
product information
sku :
ARP41698
product type :
Polyclonal Antibody
category :
Polyclonal
name :
LEP Antibody - middle region (ARP41698_P050)
size :
100 ul
gene symbol :
LEP
alias symbols :
OB, OBS, LEPD
nucleotide accession num :
NM_000230
protein accession num :
NP_000221
swissprot id :
P41159
species reactivity :
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVA
LSRLQGSLQDM
Synthetic peptide located within the following region:
LSRLQGSLQDM
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
host :
Rabbit
application :
WB, IHC
homology :
Cow: 100%; Dog: 86%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 100%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human LEP
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
