CYP2D6 antibody - N-terminal region (ARP41675_T100) | Aviva Systems Biology ARP41675 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CYP2D6 antibody - N-terminal region (ARP41675_T100)

catalog :

ARP41675

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, immunohistochemistry

product information

sku :

ARP41675

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CYP2D6 antibody - N-terminal region (ARP41675_T100)

size :

100 ul

gene symbol :

CYP2D6

alias symbols :

RP4-669P10.2, CPD6, CYP2D, CYP2D@, CYP2DL1, MGC120389, MGC120390, P450-DB1, P450C2D, CYPIID6, P450DB1, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2

nucleotide accession num :

NM_000106

protein accession num :

NP_000097

swissprot id :

P10635

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTL
RNLGLGKKSLE
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

CYP2D6 is a member of the cytochrome P45 superfamily of enzymes. The cytochrome P45 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 2% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P45 superfamily of enzymes. The cytochrome P45 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 2% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P45 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 91%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 92%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human CYP2D6

drywet surcharge :

Wet Ice

storage temperature :

-20C