ASL antibody - middle region (ARP41667_T100) | Aviva Systems Biology ARP41667 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ASL antibody - middle region (ARP41667_T100)

catalog :

ARP41667

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP41667

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ASL antibody - middle region (ARP41667_T100)

size :

100 ul

gene symbol :

ASL

alias symbols :

ASAL

nucleotide accession num :

NM_001024944

protein accession num :

NP_001020115

swissprot id :

P04424

species reactivity :

Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRS
KAGRVFGREDK
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human ASL

drywet surcharge :

Wet Ice

storage temperature :

-20C