This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
CEACAM6 antibody - middle region (ARP41504_T100)
catalog :
ARP41504
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry
product information
sku :
ARP41504
product type :
Polyclonal Antibody
category :
Polyclonal
name :
CEACAM6 antibody - middle region (ARP41504_T100)
size :
100 ul
gene symbol :
CEACAM6
alias symbols :
CD66c, CEAL, NCA
nucleotide accession num :
NM_002483
protein accession num :
NP_002474
swissprot id :
P40199
species reactivity :
Human
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGEN
LNLSCHAASNP
Synthetic peptide located within the following region:
LNLSCHAASNP
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
host :
Rabbit
application :
IHC, WB
homology :
Human: 100%
purification :
Protein A purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human CEACAM6
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
