CYP2E1 antibody - C-terminal region (ARP41424_P050) | Aviva Systems Biology ARP41424 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CYP2E1 antibody - C-terminal region (ARP41424_P050)

catalog :

ARP41424

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP41424

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CYP2E1 antibody - C-terminal region (ARP41424_P050)

size :

100 ul

gene symbol :

CYP2E1

alias symbols :

CPE1, CYP2E, P450-J, P450C2E

nucleotide accession num :

NM_000773

protein accession num :

NP_000764

swissprot id :

P05181

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG
EGLARMELFLL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

CYP2E1 is a member of the cytochrome P45 superfamily of enzymes. The cytochrome P45 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P45 superfamily of enzymes. The cytochrome P45 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.

host :

Rabbit

application :

homology :

Cow: 79%; Dog: 86%; Guinea Pig: 92%; Horse: 79%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Sheep: 79%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2E1

drywet surcharge :

Wet Ice

storage temperature :

-20C