REN antibody - C-terminal region (ARP41409_T100) | Aviva Systems Biology ARP41409 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

REN antibody - C-terminal region (ARP41409_T100)

catalog :

ARP41409

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP41409

product type :

Polyclonal Antibody

category :

Polyclonal

name :

REN antibody - C-terminal region (ARP41409_T100)

size :

100 ul

gene symbol :

REN

alias symbols :

FLJ10761, HNFJ2

nucleotide accession num :

NM_000537

protein accession num :

NP_000528

swissprot id :

P00797

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
RRNNRIGFALA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human REN

drywet surcharge :

Wet Ice

storage temperature :

-20C