EFEMP1 antibody - middle region (ARP41342_P050) | Aviva Systems Biology ARP41342 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

EFEMP1 antibody - middle region (ARP41342_P050)

catalog :

ARP41342

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP41342

product type :

Polyclonal Antibody

category :

Polyclonal

name :

EFEMP1 antibody - middle region (ARP41342_P050)

size :

100 ul

gene symbol :

EFEMP1

alias symbols :

DHRD, DRAD, FBLN3, FBNL, FLJ35535, MGC111353, MLVT, MTLV, S1-5

nucleotide accession num :

NM_004105

protein accession num :

NP_004096

swissprot id :

Q12805

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNEN
GEFYLRQTSPV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1

drywet surcharge :

Wet Ice

storage temperature :

-20C