RHOU antibody - C-terminal region (ARP41274_P050) | Aviva Systems Biology ARP41274 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RHOU antibody - C-terminal region (ARP41274_P050)

catalog :

ARP41274

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine

application :

western blot

product information

sku :

ARP41274

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RHOU antibody - C-terminal region (ARP41274_P050)

size :

100 ul

gene symbol :

RHOU

alias symbols :

ARHU, CDC42L1, DJ646B12.2, FLJ10616, WRCH1, fJ646B12.2, hG28K

nucleotide accession num :

NM_021205

protein accession num :

NP_067028

swissprot id :

Q7L0Q8

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKS
WWKKYCCFV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 79%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human RHOU

drywet surcharge :

Wet Ice

storage temperature :

-20C