FZD4 antibody - middle region (ARP41266_P050) | Aviva Systems Biology ARP41266 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FZD4 antibody - middle region (ARP41266_P050)

catalog :

ARP41266

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP41266

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FZD4 antibody - middle region (ARP41266_P050)

size :

100 ul

gene symbol :

FZD4

alias symbols :

EVR1, FEVR, FZD4S, Fz-4, FzE4, GPCR, MGC34390, CD344

nucleotide accession num :

NM_012193

protein accession num :

NP_036325

swissprot id :

Q9ULV1

species reactivity :

Cow, Guinea Pig, Horse, Human, Mouse, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGW
VKPGKGSETVV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human FZD4

drywet surcharge :

Wet Ice

storage temperature :

-20C