HNRPC antibody - N-terminal region (ARP41037_P050) | Aviva Systems Biology ARP41037 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

HNRPC antibody - N-terminal region (ARP41037_P050)

catalog :

ARP41037

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs

application :

western blot

product information

sku :

ARP41037

product type :

Polyclonal Antibody

category :

Polyclonal

name :

HNRPC antibody - N-terminal region (ARP41037_P050)

size :

100 ul

gene symbol :

HNRNPC

alias symbols :

C1, C2, HNRNP, MGC104306, MGC105117, MGC117353, MGC131677, SNRPC, hnRNPC, HNRPC

nucleotide accession num :

NM_031314

protein accession num :

NP_112604

swissprot id :

P07910

species reactivity :

Dog, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLL
SSSFDLDYDFQ
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 4S hnRNP particles.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has one RRM domain that binds to RNAs. Two alternatively spliced transcript variants have been described for this gene.

host :

Rabbit

application :

homology :

Dog: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPC

drywet surcharge :

Wet Ice

storage temperature :

-20C