This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
XRN1 antibody - middle region (ARP40931_P050)
catalog :
ARP40931
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
sku :
ARP40931
product type :
Polyclonal Antibody
category :
Polyclonal
name :
XRN1 antibody - middle region (ARP40931_P050)
size :
100 ul
gene symbol :
XRN1
alias symbols :
DKFZp434P0721, DKFZp686B22225, DKFZp686F19113, FLJ41903, SEP1
nucleotide accession num :
NM_019001
protein accession num :
NP_061874
swissprot id :
Q8IZH2
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECK
SPKAECWSQKM
Synthetic peptide located within the following region:
SPKAECWSQKM
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.SEP1 localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-67 BX6495.1 1-67 68-5188 AY137776.1 1-5121 5189-5269 BG197321.1 38-388 527-192 AC2358.16 31718-3654 c
host :
Rabbit
application :
WB
homology :
Cow: 92%; Dog: 93%; Guinea Pig: 79%; Horse: 90%; Human: 100%; Mouse: 86%; Pig: 85%; Rabbit: 100%; Rat: 100%;
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human XRN1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
