XRN1 antibody - middle region (ARP40931_P050) | Aviva Systems Biology ARP40931 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

XRN1 antibody - middle region (ARP40931_P050)

catalog :

ARP40931

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP40931

product type :

Polyclonal Antibody

category :

Polyclonal

name :

XRN1 antibody - middle region (ARP40931_P050)

size :

100 ul

gene symbol :

XRN1

alias symbols :

DKFZp434P0721, DKFZp686B22225, DKFZp686F19113, FLJ41903, SEP1

nucleotide accession num :

NM_019001

protein accession num :

NP_061874

swissprot id :

Q8IZH2

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECK
SPKAECWSQKM
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.SEP1 localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-67 BX6495.1 1-67 68-5188 AY137776.1 1-5121 5189-5269 BG197321.1 38-388 527-192 AC2358.16 31718-3654 c

host :

Rabbit

application :

homology :

Cow: 92%; Dog: 93%; Guinea Pig: 79%; Horse: 90%; Human: 100%; Mouse: 86%; Pig: 85%; Rabbit: 100%; Rat: 100%;

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human XRN1

drywet surcharge :

Wet Ice

storage temperature :

-20C