SYNCRIP antibody - middle region (ARP40641_T100) | Aviva Systems Biology ARP40641 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

SYNCRIP antibody - middle region (ARP40641_T100)

catalog :

ARP40641

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP40641

product type :

Polyclonal Antibody

category :

Polyclonal

name :

SYNCRIP antibody - middle region (ARP40641_T100)

size :

100 ul

gene symbol :

SYNCRIP

alias symbols :

GRY-RBP, NSAP1, RP1-3J17.2, dJ3J17.2, pp68, PP68, GRYRBP, HNRPQ1, hnRNP-Q

nucleotide accession num :

NM_006372

protein accession num :

NP_006363

swissprot id :

O60506

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHM
PPPTRGRGRGG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human SYNCRIP

drywet surcharge :

Wet Ice

storage temperature :

-20C