RPL32 antibody - N-terminal region (ARP40219_T100) | Aviva Systems Biology ARP40219 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RPL32 antibody - N-terminal region (ARP40219_T100)

catalog :

ARP40219

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP40219

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RPL32 antibody - N-terminal region (ARP40219_T100)

size :

100 ul

gene symbol :

RPL32

alias symbols :

L32, PP9932

nucleotide accession num :

NM_000994

protein accession num :

NP_000985

swissprot id :

P62910

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRG
IDNRVRRRFKG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

RPL32 is a ribosomal protein that is a component of the 6S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 4S subunit and a large 6S subunit. Together these subunits are composed of 4 RNA species and approximately 8 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 6S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human RPL32

drywet surcharge :

Wet Ice

storage temperature :

-20C