INSIG1 antibody - middle region (ARP40166_P050) | Aviva Systems Biology ARP40166 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

INSIG1 antibody - middle region (ARP40166_P050)

catalog :

ARP40166

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP40166

product type :

Polyclonal Antibody

category :

Polyclonal

name :

INSIG1 antibody - middle region (ARP40166_P050)

size :

100 ul

gene symbol :

INSIG2

alias symbols :

MGC26273, INSIG1

nucleotide accession num :

NM_016133

protein accession num :

NP_057217

swissprot id :

Q9Y5U4

species reactivity :

Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVM
RCVAVFVGINH
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 87%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human INSIG1

drywet surcharge :

Wet Ice

storage temperature :

-20C