EGLN2 antibody - middle region (ARP39775_P050) | Aviva Systems Biology ARP39775 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

EGLN2 antibody - middle region (ARP39775_P050)

catalog :

ARP39775

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, dogs

application :

western blot

product information

sku :

ARP39775

product type :

Polyclonal Antibody

category :

Polyclonal

name :

EGLN2 antibody - middle region (ARP39775_P050)

size :

100 ul

gene symbol :

EGLN2

alias symbols :

DKFZp434E026, EIT6, HIFPH1, HPH-3, PHD1, HPH-1, HIF-PH1

nucleotide accession num :

NM_053046

protein accession num :

NP_444274

swissprot id :

Q96KS0

species reactivity :

Dog, Human

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

AVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTG
VQGGQIPELIF
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms. The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this posttranslational modification. Multiple alternatively spliced variants, encoding the same protein, have been identified.

host :

Rabbit

application :

homology :

Dog: 85%; Human: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human EGLN2

drywet surcharge :

Wet Ice

storage temperature :

-20C