This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
SOX17 antibody - middle region (ARP39552_P050)
catalog :
ARP39552
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs
application :
western blot, immunohistochemistry, flow cytometry
product information
sku :
ARP39552
product type :
Polyclonal Antibody
category :
Polyclonal
name :
SOX17 antibody - middle region (ARP39552_P050)
size :
100 ul
gene symbol :
SOX17
alias symbols :
FLJ22252, VUR3
nucleotide accession num :
NM_022454
protein accession num :
NP_071899
swissprot id :
Q9H6I2
species reactivity :
Dog, Guinea Pig, Human, Mouse, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSV
VSDASSAVYYC
Synthetic peptide located within the following region:
VSDASSAVYYC
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
host :
Rabbit
application :
WB, IHC, FC
homology :
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human SOX17
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
