SUZ12 antibody - C-terminal region (ARP39190_P050) | Aviva Systems Biology ARP39190 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

SUZ12 antibody - C-terminal region (ARP39190_P050)

catalog :

ARP39190

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP39190

product type :

Polyclonal Antibody

category :

Polyclonal

name :

SUZ12 antibody - C-terminal region (ARP39190_P050)

size :

100 ul

gene symbol :

SUZ12

alias symbols :

CHET9, JJAZ1, KIAA0160

nucleotide accession num :

NM_015355

protein accession num :

NP_056170

swissprot id :

Q15022

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

ESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGV
SKQSKKQKL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

A chromosomal aberration involving SUZ12 may be a cause of endometrial stromal tumors. Translocation t (7;17)(p15;q21) with JAZF1 generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. The specific function of this gene has not yet been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human SUZ12

drywet surcharge :

Wet Ice

storage temperature :

-20C