TARDBP antibody - N-terminal region (ARP38941_T100) | Aviva Systems Biology ARP38941 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

TARDBP antibody - N-terminal region (ARP38941_T100)

catalog :

ARP38941

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP38941

product type :

Polyclonal Antibody

category :

Polyclonal

name :

TARDBP antibody - N-terminal region (ARP38941_T100)

size :

100 ul

gene symbol :

TARDBP

alias symbols :

ALS10, TDP-43

nucleotide accession num :

NM_007375

protein accession num :

NP_031401

swissprot id :

Q13148

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGAC
GLRYRNPVSQC
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 2.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human TARDBP

drywet surcharge :

Wet Ice

storage temperature :

-20C