This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
FOXA1 antibody - N-terminal region (ARP38479_P050)
catalog :
ARP38479
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot
product information
sku :
ARP38479
product type :
Polyclonal Antibody
category :
Polyclonal
name :
FOXA1 antibody - N-terminal region (ARP38479_P050)
size :
100 ul
gene symbol :
FOXA1
alias symbols :
HNF3A, MGC33105, TCF3A
nucleotide accession num :
NM_004496
protein accession num :
NP_004487
swissprot id :
P55317
species reactivity :
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGS
MNSMNTYMTMN
Synthetic peptide located within the following region:
MNSMNTYMTMN
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
host :
Rabbit
application :
WB
homology :
Cow: 93%; Dog: 93%; Guinea Pig: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 85%; Rat: 93%; Zebrafish: 85%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
