FOXA1 antibody - N-terminal region (ARP38479_P050) | Aviva Systems Biology ARP38479 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FOXA1 antibody - N-terminal region (ARP38479_P050)

catalog :

ARP38479

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP38479

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FOXA1 antibody - N-terminal region (ARP38479_P050)

size :

100 ul

gene symbol :

FOXA1

alias symbols :

HNF3A, MGC33105, TCF3A

nucleotide accession num :

NM_004496

protein accession num :

NP_004487

swissprot id :

P55317

species reactivity :

Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGS
MNSMNTYMTMN
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 85%; Rat: 93%; Zebrafish: 85%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1

drywet surcharge :

Wet Ice

storage temperature :

-20C