This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
E2F3 antibody - C-terminal region (ARP38089_P050)
catalog :
ARP38089
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
sku :
ARP38089
product type :
Polyclonal Antibody
category :
Polyclonal
name :
E2F3 antibody - C-terminal region (ARP38089_P050)
size :
100 ul
gene symbol :
E2F3
alias symbols :
E2F-3
nucleotide accession num :
NM_001243076
protein accession num :
CAH18140
swissprot id :
Q68DT0
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGI
SDLFDAYDLEK
Synthetic peptide located within the following region:
SDLFDAYDLEK
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
purification :
Affinity Purified
clonality :
Polyclonal
specificity :
The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (334aa, 37kDa) of human E2F3.
immunogen :
The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments