E2F3 antibody - C-terminal region (ARP38089_P050) | Aviva Systems Biology ARP38089 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

E2F3 antibody - C-terminal region (ARP38089_P050)

catalog :

ARP38089

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP38089

product type :

Polyclonal Antibody

category :

Polyclonal

name :

E2F3 antibody - C-terminal region (ARP38089_P050)

size :

100 ul

gene symbol :

E2F3

alias symbols :

E2F-3

nucleotide accession num :

NM_001243076

protein accession num :

CAH18140

swissprot id :

Q68DT0

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGI
SDLFDAYDLEK
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

specificity :

The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (334aa, 37kDa) of human E2F3.

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3

drywet surcharge :

Wet Ice

storage temperature :

-20C